Lineage for d1asx__ (1asx -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21364Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 21416Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein)
  6. 21417Protein Thermosome [52035] (1 species)
  7. 21418Species Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries)
  8. 21422Domain d1asx__: 1asx - [30821]

Details for d1asx__

PDB Entry: 1asx (more details), 2.8 Å

PDB Description: apical domain of the chaperonin from thermoplasma acidophilum

SCOP Domain Sequences for d1asx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asx__ c.8.5.2 (-) Thermosome {Thermoplasma acidophilum}
msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
lddltpsvlgeaetveerkigddrmtfvmgck

SCOP Domain Coordinates for d1asx__:

Click to download the PDB-style file with coordinates for d1asx__.
(The format of our PDB-style files is described here.)

Timeline for d1asx__: