Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
Protein Thermosome, A-domain [52035] (4 species) |
Species Thermoplasma acidophilum, alpha chain [TaxId:2303] [100946] (4 PDB entries) |
Domain d1asxa_: 1asx A: [30821] apical domain only complexed with po4 |
PDB Entry: 1asx (more details), 2.8 Å
SCOPe Domain Sequences for d1asxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asxa_ c.8.5.2 (A:) Thermosome, A-domain {Thermoplasma acidophilum, alpha chain [TaxId: 2303]} msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd lddltpsvlgeaetveerkigddrmtfvmgck
Timeline for d1asxa_: