SCOPe 2.08: Domain d4quyq1: 4quy Q:1-234

Lineage for d4quyq1 (4quy Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4quyq1: 4quy Q:1-234 [308200]
   Other proteins in same PDB: d4quya_, d4quyb_, d4quyc2, d4quyd_, d4quye_, d4quyf_, d4quyg_, d4quyh_, d4quyi_, d4quyj_, d4quyk_, d4quyl_, d4quym_, d4quyn_, d4quyo_, d4quyp_, d4quyq2, d4quyr_, d4quys_, d4quyt_, d4quyu_, d4quyv_, d4quyw_, d4quyx_, d4quyy_, d4quyz_
   automated match to d4eu2a_
   complexed with cl, mg; mutant

Details for d4quyq1

PDB Entry: 4quy, 2.8 Å

PDB Description: yCP beta5-A49S-mutant

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4quyq1:

Sequence; same for both SEQRES and ATOM records:

>d4quyq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4quyq1:

• d4quyq1 first appeared in SCOPe 2.06, called d4quyq_
  
• d4quyq1 was called d4quyq_ in SCOPe 2.07