SCOPe 2.05: Domain d1a6db2: 1a6d B:216-367

Lineage for d1a6db2 (1a6d B:216-367)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (4 species)

7. Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100947] (3 PDB entries)

8. Domain d1a6db2: 1a6d B:216-367 [30820]
   Other proteins in same PDB: d1a6da1, d1a6da3, d1a6db1, d1a6db3

Details for d1a6db2

PDB Entry: 1a6d, 2.6 Å

PDB Description: thermosome from t. acidophilum

PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6db2:

Sequence; same for both SEQRES and ATOM records:

>d1a6db2 c.8.5.2 (B:216-367) Thermosome, A-domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr
emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid
eisssdlgtaerveqvkvgedymtfvtgcknp

Timeline for d1a6db2:

• d1a6db2 first appeared (with stable ids) in SCOP 1.55
  
• d1a6db2 appears in SCOPe 2.04
  
• d1a6db2 appears in SCOPe 2.06
  
• d1a6db2 appears in the current release, SCOPe 2.08