SCOP 1.55: Domain d1a6db2: 1a6d B:216-367

Lineage for d1a6db2 (1a6d B:216-367)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)

4. Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein)

6. Protein Thermosome [52035] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries)

8. Domain d1a6db2: 1a6d B:216-367 [30820]
   Other proteins in same PDB: d1a6da1, d1a6da3, d1a6db1, d1a6db3

Details for d1a6db2

PDB Entry: 1a6d, 2.6 Å

PDB Description: thermosome from t. acidophilum

SCOP Domain Sequences for d1a6db2:

Sequence; same for both SEQRES and ATOM records:

>d1a6db2 c.8.5.2 (B:216-367) Thermosome {Thermoplasma acidophilum}
giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr
emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid
eisssdlgtaerveqvkvgedymtfvtgcknp

Timeline for d1a6db2:

• d1a6db2 appears in SCOP 1.57
  
• d1a6db2 appears in the current release, SCOPe 2.08