Lineage for d4quym_ (4quy M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993916Domain d4quym_: 4quy M: [308196]
    Other proteins in same PDB: d4quya_, d4quyc1, d4quyc2, d4quyd_, d4quye_, d4quyg_, d4quyi_, d4quyj_, d4quyk_, d4quyl_, d4quyn_, d4quyo_, d4quyq1, d4quyq2, d4quyr_, d4quys_, d4quyu_, d4quyw_, d4quyx_, d4quyy_, d4quyz_
    automated match to d4j70m_
    complexed with cl, mg; mutant

Details for d4quym_

PDB Entry: 4quy (more details), 2.8 Å

PDB Description: yCP beta5-A49S-mutant
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4quym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quym_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4quym_:

Click to download the PDB-style file with coordinates for d4quym_.
(The format of our PDB-style files is described here.)

Timeline for d4quym_: