Lineage for d1a6da2 (1a6d A:215-367)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21364Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 21416Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein)
  6. 21417Protein Thermosome [52035] (1 species)
  7. 21418Species Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries)
  8. 21420Domain d1a6da2: 1a6d A:215-367 [30819]
    Other proteins in same PDB: d1a6da1, d1a6da3, d1a6db1, d1a6db3

Details for d1a6da2

PDB Entry: 1a6d (more details), 2.6 Å

PDB Description: thermosome from t. acidophilum

SCOP Domain Sequences for d1a6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6da2 c.8.5.2 (A:215-367) Thermosome {Thermoplasma acidophilum}
gividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetntfk
qmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtdld
dltpsvlgeaetveerkigddrmtfvmgcknpk

SCOP Domain Coordinates for d1a6da2:

Click to download the PDB-style file with coordinates for d1a6da2.
(The format of our PDB-style files is described here.)

Timeline for d1a6da2: