| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) ![]() |
| Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
| Protein Thermosome, A-domain [52035] (4 species) |
| Species Thermoplasma acidophilum, alpha chain [TaxId:2303] [100946] (4 PDB entries) |
| Domain d1a6da2: 1a6d A:215-367 [30819] Other proteins in same PDB: d1a6da1, d1a6da3, d1a6db1, d1a6db3 |
PDB Entry: 1a6d (more details), 2.6 Å
SCOPe Domain Sequences for d1a6da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6da2 c.8.5.2 (A:215-367) Thermosome, A-domain {Thermoplasma acidophilum, alpha chain [TaxId: 2303]}
gividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetntfk
qmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtdld
dltpsvlgeaetveerkigddrmtfvmgcknpk
Timeline for d1a6da2: