Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4quxv_: 4qux V: [308180] Other proteins in same PDB: d4quxa_, d4quxc_, d4quxe_, d4quxi_, d4quxj_, d4quxk_, d4quxl_, d4quxn_, d4quxo_, d4quxq_, d4quxs_, d4quxw_, d4quxx_, d4quxy_, d4quxz_ automated match to d4r17h_ complexed with mg; mutant |
PDB Entry: 4qux (more details), 3 Å
SCOPe Domain Sequences for d4quxv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quxv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4quxv_: