SCOP 1.67: Domain d1ass__: 1ass -

Lineage for d1ass__ (1ass -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (4 species)

7. Species Archaeon Thermoplasma acidophilum, alpha chain [TaxId:2303] [100946] (4 PDB entries)

8. Domain d1ass__: 1ass - [30818]
   apical domain only
   complexed with na, po4

Details for d1ass__

PDB Entry: 1ass, 2.3 Å

PDB Description: apical domain of the chaperonin from thermoplasma acidophilum

SCOP Domain Sequences for d1ass__:

Sequence; same for both SEQRES and ATOM records:

>d1ass__ c.8.5.2 (-) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, alpha chain}
msgividkekvhskmpdvvknakialidsaleikkteieakvqisdpskiqdflnqetnt
fkqmvekikksganvvlcqkgiddvaqhylakegiyavrrvkksdmeklakatgakivtd
lddltpsvlgeaetveerkigddrmtfvmgck

Timeline for d1ass__:

• d1ass__ first appeared (with stable ids) in SCOP 1.55
  
• d1ass__ appears in SCOP 1.65
  
• d1ass__ appears in SCOP 1.69
  
• d1ass__ appears in the current release, SCOPe 2.08, called d1assa_