SCOPe 2.07: Domain d4quxn_: 4qux N:

Lineage for d4quxn_ (4qux N:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4quxn_: 4qux N: [308173]
   Other proteins in same PDB: d4quxb_, d4quxc_, d4quxf_, d4quxg_, d4quxh_, d4quxm_, d4quxp_, d4quxq_, d4quxt_, d4quxu_, d4quxv_
   automated match to d4j70n_
   complexed with mg; mutant

Details for d4quxn_

PDB Entry: 4qux, 3 Å

PDB Description: yCP beta5-A49T-mutant

PDB Compounds: (N:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d4quxn_:

Sequence; same for both SEQRES and ATOM records:

>d4quxn_ d.153.1.4 (N:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

Timeline for d4quxn_:

• d4quxn_ first appeared in SCOPe 2.06
  
• d4quxn_ appears in the current release, SCOPe 2.08