Lineage for d1srva_ (1srv A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389745Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 389746Protein GroEL, A domain [52031] (3 species)
  7. 389873Species Thermus thermophilus [TaxId:274] [52033] (1 PDB entry)
  8. 389874Domain d1srva_: 1srv A: [30817]

Details for d1srva_

PDB Entry: 1srv (more details), 1.7 Å

PDB Description: thermus thermophilus groel (hsp60 class) fragment (apical domain) comprising residues 192-336

SCOP Domain Sequences for d1srva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srva_ c.8.5.1 (A:) GroEL, A domain {Thermus thermophilus}
gyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkplliia
edvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfklen
atlsmlgraervritkdettivggk

SCOP Domain Coordinates for d1srva_:

Click to download the PDB-style file with coordinates for d1srva_.
(The format of our PDB-style files is described here.)

Timeline for d1srva_: