Lineage for d1grl_2 (1grl 191-366)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577176Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (9 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 577291Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 577292Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 577293Protein GroEL, A domain [52031] (4 species)
  7. 577294Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 577411Domain d1grl_2: 1grl 191-366 [30816]
    Other proteins in same PDB: d1grl_1, d1grl_3
    mutant

Details for d1grl_2

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms

SCOP Domain Sequences for d1grl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grl_2 c.8.5.1 (191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1grl_2:

Click to download the PDB-style file with coordinates for d1grl_2.
(The format of our PDB-style files is described here.)

Timeline for d1grl_2: