Lineage for d4qsxa1 (4qsx A:981-1108)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (679 PDB entries)
  8. 2317440Domain d4qsxa1: 4qsx A:981-1108 [308159]
    Other proteins in same PDB: d4qsxa2
    automated match to d4tz2a_
    complexed with 38s, edo, so4

Details for d4qsxa1

PDB Entry: 4qsx (more details), 1.93 Å

PDB Description: Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) in complex with 3'-deoxy thymidine
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4qsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qsxa1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

SCOPe Domain Coordinates for d4qsxa1:

Click to download the PDB-style file with coordinates for d4qsxa1.
(The format of our PDB-style files is described here.)

Timeline for d4qsxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qsxa2