SCOPe 2.08: Domain d4qgxa_: 4qgx A:

Lineage for d4qgxa_ (4qgx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries)

8. Domain d4qgxa_: 4qgx A: [308143]
   automated match to d2g7ba_
   complexed with lmc; mutant

Details for d4qgxa_

PDB Entry: 4qgx, 1.47 Å

PDB Description: crystal structure of the r132k:r111l:l121e mutant of cellular retinoic acid binding proteinii complexed with a synthetic ligand (merocyanine) at 1.47 angstrom resolution

PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d4qgxa_:

Sequence; same for both SEQRES and ATOM records:

>d4qgxa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
etmtaddvvctkvyvre

Timeline for d4qgxa_:

• d4qgxa_ first appeared in SCOPe 2.06
  
• d4qgxa_ appears in SCOPe 2.07