Lineage for d4qgwa_ (4qgw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396009Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 2396016Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (53 PDB entries)
  8. 2396048Domain d4qgwa_: 4qgw A: [308141]
    automated match to d3fa9a_
    complexed with b3p, lmc; mutant

Details for d4qgwa_

PDB Entry: 4qgw (more details), 1.77 Å

PDB Description: Crystal sturcture of the R132K:R111L:L121D mutant of Cellular Retinoic Acid Binding ProteinII complexed with a synthetic ligand (Merocyanine) at 1.77 angstrom resolution
PDB Compounds: (A:) Cellular retinoic acid-binding protein 2

SCOPe Domain Sequences for d4qgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgwa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
dtmtaddvvctkvyvre

SCOPe Domain Coordinates for d4qgwa_:

Click to download the PDB-style file with coordinates for d4qgwa_.
(The format of our PDB-style files is described here.)

Timeline for d4qgwa_: