SCOPe 2.08: Domain d4qf1b2: 4qf1 B:108-208

Lineage for d4qf1b2 (4qf1 B:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4qf1b2: 4qf1 B:108-208 [308132]
   Other proteins in same PDB: d4qf1a_, d4qf1b1, d4qf1h_, d4qf1l1
   automated match to d1lila2
   complexed with cl, mes, pg4, pge

Details for d4qf1b2

PDB Entry: 4qf1, 2.4 Å

PDB Description: crystal structure of unliganded ch59ua, the inferred unmutated ancestor of the rv144 anti-hiv antibody lineage producing ch59

PDB Compounds: (B:) Inferred unmutated ancestor (UA) of anti-HIV antibody CH59

SCOPe Domain Sequences for d4qf1b2:

Sequence; same for both SEQRES and ATOM records:

>d4qf1b2 b.1.1.2 (B:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4qf1b2:

• d4qf1b2 first appeared in SCOPe 2.06
  
• d4qf1b2 appears in SCOPe 2.07