SCOPe 2.08: Domain d4qf1b1: 4qf1 B:1-107

Lineage for d4qf1b1 (4qf1 B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4qf1b1: 4qf1 B:1-107 [308131]
   Other proteins in same PDB: d4qf1a_, d4qf1b2, d4qf1h_, d4qf1l2
   automated match to d1lila1
   complexed with cl, mes, pg4, pge

Details for d4qf1b1

PDB Entry: 4qf1, 2.4 Å

PDB Description: crystal structure of unliganded ch59ua, the inferred unmutated ancestor of the rv144 anti-hiv antibody lineage producing ch59

PDB Compounds: (B:) Inferred unmutated ancestor (UA) of anti-HIV antibody CH59

SCOPe Domain Sequences for d4qf1b1:

Sequence; same for both SEQRES and ATOM records:

>d4qf1b1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvspgqtaritcsgdalpkkyaywyqqksgqapvlviyedskrpsgiper
fsgsssgtmatltisgaqvedeadyycystdssgnhrvfgggtkltvlg

Timeline for d4qf1b1:

• d4qf1b1 first appeared in SCOPe 2.06
  
• d4qf1b1 appears in SCOPe 2.07