Lineage for d4qblf_ (4qbl F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882890Family c.52.1.35: Virus-type replication-repair nuclease (VRR-Nuc) [310663] (3 proteins)
    Pfam PF08774
  6. 2882891Protein psNUC [310831] (1 species)
  7. 2882892Species Psychrobacter sp. [TaxId:349106] [311100] (1 PDB entry)
  8. 2882898Domain d4qblf_: 4qbl F: [308118]
    complexed with mg

Details for d4qblf_

PDB Entry: 4qbl (more details), 2 Å

PDB Description: vrr_nuc domain protein
PDB Compounds: (F:) vrr-nuc

SCOPe Domain Sequences for d4qblf_:

Sequence, based on SEQRES records: (download)

>d4qblf_ c.52.1.35 (F:) psNUC {Psychrobacter sp. [TaxId: 349106]}
lkgltedevqtvvmnwskrqkfkgrplfdyihhspnggkraakigssgkryspeaakfkr
mgvkagypdliidiargayhglrieikkdgnsyatpaqkeriemlakegycavvakgidn
visviqqyiklgdfdgvsqlt

Sequence, based on observed residues (ATOM records): (download)

>d4qblf_ c.52.1.35 (F:) psNUC {Psychrobacter sp. [TaxId: 349106]}
lkgltedevqtvvmnwskrqkfkgrplfdyihhspaakfkrmgvkagypdliidiargay
hglrieikkdgnsyatpaqkeriemlakegycavvakgidnvisviqqyiklgdfdgvsq
lt

SCOPe Domain Coordinates for d4qblf_:

Click to download the PDB-style file with coordinates for d4qblf_.
(The format of our PDB-style files is described here.)

Timeline for d4qblf_: