Lineage for d4qblc_ (4qbl C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460484Family c.52.1.35: Virus-type replication-repair nuclease (VRR-Nuc) [310663] (3 protein domains)
    Pfam PF08774
  6. 2460485Protein psNUC [310831] (1 species)
  7. 2460486Species Psychrobacter sp. [TaxId:349106] [311100] (1 PDB entry)
  8. 2460489Domain d4qblc_: 4qbl C: [308115]
    complexed with mg

Details for d4qblc_

PDB Entry: 4qbl (more details), 2 Å

PDB Description: vrr_nuc domain protein
PDB Compounds: (C:) vrr-nuc

SCOPe Domain Sequences for d4qblc_:

Sequence, based on SEQRES records: (download)

>d4qblc_ c.52.1.35 (C:) psNUC {Psychrobacter sp. [TaxId: 349106]}
rlkgltedevqtvvmnwskrqkfkgrplfdyihhspnggkraakigssgkryspeaakfk
rmgvkagypdliidiargayhglrieikkdgnsyatpaqkeriemlakegycavvakgid
nvisviqqyiklgdfdgvsqlt

Sequence, based on observed residues (ATOM records): (download)

>d4qblc_ c.52.1.35 (C:) psNUC {Psychrobacter sp. [TaxId: 349106]}
rlkgltedevqtvvmnwskrqkfkgrplfdyihhspaakfkrmgvkagypdliidiarga
yhglrieikkdgnsyatpaqkeriemlakegycavvakgidnvisviqqyiklgdfdgvs
qlt

SCOPe Domain Coordinates for d4qblc_:

Click to download the PDB-style file with coordinates for d4qblc_.
(The format of our PDB-style files is described here.)

Timeline for d4qblc_: