Lineage for d4q6aa_ (4q6a A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511755Species Staphylococcus aureus [TaxId:1435480] [311417] (3 PDB entries)
  8. 2511757Domain d4q6aa_: 4q6a A: [308111]
    automated match to d4qi9a_
    complexed with act, gol, nap; mutant

Details for d4q6aa_

PDB Entry: 4q6a (more details), 2.1 Å

PDB Description: Staphylococcus aureus V31L, F98Y Mutant Dihydrofolate Reductase Complexed with NADPH
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4q6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q6aa_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1435480]}
tlsilvahdlqrvigfenqlpwhlpndlkhlkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d4q6aa_:

Click to download the PDB-style file with coordinates for d4q6aa_.
(The format of our PDB-style files is described here.)

Timeline for d4q6aa_: