SCOPe 2.06: Domain d4q6aa_: 4q6a A:

Lineage for d4q6aa_ (4q6a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1435480] [311417] (3 PDB entries)

8. Domain d4q6aa_: 4q6a A: [308111]
   automated match to d4qi9a_
   complexed with act, gol, nap; mutant

Details for d4q6aa_

PDB Entry: 4q6a, 2.1 Å

PDB Description: Staphylococcus aureus V31L, F98Y Mutant Dihydrofolate Reductase Complexed with NADPH

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4q6aa_:

Sequence; same for both SEQRES and ATOM records:

>d4q6aa_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1435480]}
tlsilvahdlqrvigfenqlpwhlpndlkhlkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d4q6aa_:

• d4q6aa_ is new in SCOPe 2.06-stable
  
• d4q6aa_ appears in SCOPe 2.07
  
• d4q6aa_ appears in the current release, SCOPe 2.08