Lineage for d4q67a_ (4q67 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904301Species Staphylococcus aureus [TaxId:1435480] [311417] (3 PDB entries)
  8. 2904302Domain d4q67a_: 4q67 A: [308110]
    automated match to d4qi9a_
    complexed with nap; mutant

Details for d4q67a_

PDB Entry: 4q67 (more details), 2.04 Å

PDB Description: Staphylococcus aureus F98Y mutant dihydrofolate reductase complexed with NADPH
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4q67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q67a_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1435480]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d4q67a_:

Click to download the PDB-style file with coordinates for d4q67a_.
(The format of our PDB-style files is described here.)

Timeline for d4q67a_: