| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (28 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1435480] [311417] (3 PDB entries) |
| Domain d4q67a_: 4q67 A: [308110] automated match to d4qi9a_ complexed with nap; mutant |
PDB Entry: 4q67 (more details), 2.04 Å
SCOPe Domain Sequences for d4q67a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q67a_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1435480]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk
Timeline for d4q67a_: