![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
![]() | Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) ![]() |
![]() | Family c.8.5.1: GroEL [52030] (1 protein) |
![]() | Protein GroEL [52031] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52032] (10 PDB entries) |
![]() | Domain d1aonj2: 1aon J:191-366 [30811] Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |
PDB Entry: 1aon (more details), 3 Å
SCOP Domain Sequences for d1aonj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aonj2 c.8.5.1 (J:191-366) GroEL {Escherichia coli} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1aonj2:
![]() Domains from other chains: (mouse over for more information) d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |