Lineage for d1aonj2 (1aon J:191-366)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119667Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) (S)
  5. 119668Family c.8.5.1: GroEL [52030] (1 protein)
  6. 119669Protein GroEL [52031] (3 species)
  7. 119670Species Escherichia coli [TaxId:562] [52032] (10 PDB entries)
  8. 119711Domain d1aonj2: 1aon J:191-366 [30811]
    Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aonj2

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

SCOP Domain Sequences for d1aonj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aonj2 c.8.5.1 (J:191-366) GroEL {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1aonj2:

Click to download the PDB-style file with coordinates for d1aonj2.
(The format of our PDB-style files is described here.)

Timeline for d1aonj2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aona1, d1aona2, d1aona3, d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_