SCOPe 2.08: Domain d4q55a_: 4q55 A:

Lineage for d4q55a_ (4q55 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:471876] [257616] (2 PDB entries)

8. Domain d4q55a_: 4q55 A: [308108]
   automated match to d4qt4a_

Details for d4q55a_

PDB Entry: 4q55, 2.19 Å

PDB Description: Crystal structure of peptidyl-tRNA hydrolase from a Gram-positive bacterium, Streptococcus pyogenes at 2.19A resolution shows the closed structure of the substrate binding cleft

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4q55a_:

Sequence; same for both SEQRES and ATOM records:

>d4q55a_ c.56.3.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf
vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii
ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf
ektmqkfng

Timeline for d4q55a_:

• d4q55a_ first appeared in SCOPe 2.06
  
• d4q55a_ appears in SCOPe 2.07