Lineage for d4q55a_ (4q55 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889371Species Streptococcus pyogenes [TaxId:471876] [257616] (2 PDB entries)
  8. 2889374Domain d4q55a_: 4q55 A: [308108]
    automated match to d4qt4a_

Details for d4q55a_

PDB Entry: 4q55 (more details), 2.19 Å

PDB Description: Crystal structure of peptidyl-tRNA hydrolase from a Gram-positive bacterium, Streptococcus pyogenes at 2.19A resolution shows the closed structure of the substrate binding cleft
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4q55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q55a_ c.56.3.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf
vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii
ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf
ektmqkfng

SCOPe Domain Coordinates for d4q55a_:

Click to download the PDB-style file with coordinates for d4q55a_.
(The format of our PDB-style files is described here.)

Timeline for d4q55a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q55b_