SCOP 1.75: Domain d1aoni2: 1aon I:191-366

Lineage for d1aoni2 (1aon I:191-366)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
this domain is thought to be mobile in most multi-domain proteins known to contain it

Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
Protein GroEL, A domain [52031] (4 species)
Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)

Domain d1aoni2: 1aon I:191-366 [30810]
Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_

Details for d1aoni2

PDB Entry: 1aon (more details), 3 Å

PDB Description: crystal structure of the asymmetric chaperonin complex groel/groes/(adp)7

PDB Compounds: (I:) groEL

SCOP Domain Sequences for d1aoni2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoni2 c.8.5.1 (I:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1aoni2:

Click to download the PDB-style file with coordinates for d1aoni2.
(The format of our PDB-style files is described here.)

Timeline for d1aoni2: