SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4q3vd_ (4q3v D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115695Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2115696Protein automated matches [190626] (8 species)
    not a true protein
  7. 2115697Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [267991] (10 PDB entries)
  8. 2115737Domain d4q3vd_: 4q3v D: [308091]
    automated match to d4q3ud_
    complexed with gol, mn, s2c

Details for d4q3vd_

PDB Entry: 4q3v (more details), 2.7 Å

PDB Description: Crystal structure of Schistosoma mansoni arginase in complex with inhibitor BEC
PDB Compounds: (D:) arginase

SCOPe Domain Sequences for d4q3vd_:

Sequence, based on SEQRES records: (download)

>d4q3vd_ c.42.1.0 (D:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
llytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelneae
dpqrfgmkwsrsfslttlriaerveelmkqsnkhtvelsgskstplvivggdhsmatgti
lghaeakpdlcvlwidahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikpc
lnasniayiglrdldahethdirkhgiayftmldvdrmgieavikeallavnprlekaih
lsfdidaldplvapstgtavpggltlreglriceevsatgklsvvelaelnpllgsqedv
lktqssavhilraclghcrsghlpfkvrnltdqgimsraahm

Sequence, based on observed residues (ATOM records): (download)

>d4q3vd_ c.42.1.0 (D:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
llytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelneae
dpqrfgmkwsrsfslttlriaerveelmkstplvivggdhsmatgtilghaeakpdlcvl
widahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikpclnasniayiglrd
ldahethdirkhgiayftmldvdrmgieavikeallavnprlekaihlsfdidaldplva
pstgtavpggltlreglriceevsatgklsvvelaelnpllgsqedvlktqssavhilra
clghcrsghlpfkvrnltdqgimsraahm

SCOPe Domain Coordinates for d4q3vd_:

Click to download the PDB-style file with coordinates for d4q3vd_.
(The format of our PDB-style files is described here.)

Timeline for d4q3vd_:

  • d4q3vd_ is new in SCOPe 2.06-stable