![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
![]() | Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) ![]() |
![]() | Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
![]() | Protein automated matches [190626] (14 species) not a true protein |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [267991] (10 PDB entries) |
![]() | Domain d4q3qb_: 4q3q B: [308077] automated match to d4q3ud_ complexed with abh, gol, mn |
PDB Entry: 4q3q (more details), 2 Å
SCOPe Domain Sequences for d4q3qb_:
Sequence, based on SEQRES records: (download)
>d4q3qb_ c.42.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} kllytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelnea edpqrfgmkwsrsfslttlriaerveelmkqsnkhtvelsgskstplvivggdhsmatgt ilghaeakpdlcvlwidahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikp clnasniayiglrdldahethdirkhgiayftmldvdrmgieavikeallavnprlekai hlsfdidaldplvapstgtavpggltlreglriceevsatgklsvvelaelnpllgsqed vlktqssavhilraclghcrsghlpfkvrnltdqgimsraahmq
>d4q3qb_ c.42.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} kllytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelnea edpqrfgmkwsrsfslttlriaerveelmkqsnkstplvivggdhsmatgtilghaeakp dlcvlwidahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikpclnasniay iglrdldahethdirkhgiayftmldvdrmgieavikeallavnprlekaihlsfdidal dplvapstgtavpggltlreglriceevsatgklsvvelaelnpllgsqedvlktqssav hilraclghcrsghlpfkvrnltdqgimsraahmq
Timeline for d4q3qb_: