Lineage for d4q3pb_ (4q3p B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115695Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2115696Protein automated matches [190626] (8 species)
    not a true protein
  7. 2115697Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [267991] (10 PDB entries)
  8. 2115727Domain d4q3pb_: 4q3p B: [308073]
    automated match to d4q3ud_
    complexed with gol, mn

Details for d4q3pb_

PDB Entry: 4q3p (more details), 2.5 Å

PDB Description: Crystal structure of Schistosoma mansoni arginase
PDB Compounds: (B:) arginase

SCOPe Domain Sequences for d4q3pb_:

Sequence, based on SEQRES records: (download)

>d4q3pb_ c.42.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
kllytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelnea
edpqrfgmkwsrsfslttlriaerveelmkqsnkhtvelsgskstplvivggdhsmatgt
ilghaeakpdlcvlwidahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikp
clnasniayiglrdldahethdirkhgiayftmldvdrmgieavikeallavnprlekai
hlsfdidaldplvapstgtavpggltlreglriceevsatgklsvvelaelnpllgsqed
vlktqssavhilraclghcrsghlpfkvrnltdqgimsraahmqt

Sequence, based on observed residues (ATOM records): (download)

>d4q3pb_ c.42.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
kllytsanflgiptnrgqpkigtyqgpelirksnffqlvaedgiqltdcgdiipvelnea
edpqrfgmkwsrsfslttlriaerveelmkqskstplvivggdhsmatgtilghaeakpd
lcvlwidahgdintplnsasgnmhgmplsflvkelqdqipwlddfegikpclnasniayi
glrdldahethdirkhgiayftmldvdrmgieavikeallavnprlekaihlsfdidald
plvapstgtavpggltlreglriceevsatgklsvvelaelnpllgsqedvlktqssavh
ilraclghcrsghlpfkvrnltdqgimsraahmqt

SCOPe Domain Coordinates for d4q3pb_:

Click to download the PDB-style file with coordinates for d4q3pb_.
(The format of our PDB-style files is described here.)

Timeline for d4q3pb_:

  • d4q3pb_ is new in SCOPe 2.06-stable