![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.12: PhoU-like [109755] (2 families) ![]() duplication: consists of two sequence each repeats adopting this fold |
![]() | Family a.7.12.0: automated matches [227189] (1 protein) not a true family |
![]() | Protein automated matches [226911] (2 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [311416] (1 PDB entry) |
![]() | Domain d4q25b_: 4q25 B: [308071] automated match to d2i0ma_ |
PDB Entry: 4q25 (more details), 2.28 Å
SCOPe Domain Sequences for d4q25b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q25b_ a.7.12.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} qfnaeledvrshllamgglvekqvndavnalidadsglaqqvreiddqinqmernideec vrilarrqpaasdlrliisisksvidlerigdeaskvarraiqlceegesprgyvevrhi gsqvqkmvqealdafarfdadlalsvaqydktvdreyktalrelvtymmedpraisrvln iiwalrslerigdharniaelviylvrgt
Timeline for d4q25b_: