SCOPe 2.08: Domain d4q25a_: 4q25 A:

Lineage for d4q25a_ (4q25 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.12: PhoU-like [109755] (2 families)
   duplication: consists of two sequence each repeats adopting this fold

5. Family a.7.12.0: automated matches [227189] (1 protein)
   not a true family

6. Protein automated matches [226911] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [311416] (1 PDB entry)

8. Domain d4q25a_: 4q25 A: [308070]
   automated match to d2i0ma_

Details for d4q25a_

PDB Entry: 4q25, 2.28 Å

PDB Description: Crystal structure of PhoU from Pseudomonas aeruginosa

PDB Compounds: (A:) Phosphate-specific transport system accessory protein PhoU homolog

SCOPe Domain Sequences for d4q25a_:

Sequence; same for both SEQRES and ATOM records:

>d4q25a_ a.7.12.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sqqfnaeledvrshllamgglvekqvndavnalidadsglaqqvreiddqinqmernide
ecvrilarrqpaasdlrliisisksvidlerigdeaskvarraiqlceegesprgyvevr
higsqvqkmvqealdafarfdadlalsvaqydktvdreyktalrelvtymmedpraisrv
lniiwalrslerigdharniaelviylvrgt

Timeline for d4q25a_:

• d4q25a_ first appeared in SCOPe 2.06
  
• d4q25a_ appears in SCOPe 2.07