Lineage for d4q25a_ (4q25 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696852Superfamily a.7.12: PhoU-like [109755] (2 families) (S)
    duplication: consists of two sequence each repeats adopting this fold
  5. 2696875Family a.7.12.0: automated matches [227189] (1 protein)
    not a true family
  6. 2696876Protein automated matches [226911] (2 species)
    not a true protein
  7. 2696877Species Pseudomonas aeruginosa [TaxId:208964] [311416] (1 PDB entry)
  8. 2696878Domain d4q25a_: 4q25 A: [308070]
    automated match to d2i0ma_

Details for d4q25a_

PDB Entry: 4q25 (more details), 2.28 Å

PDB Description: Crystal structure of PhoU from Pseudomonas aeruginosa
PDB Compounds: (A:) Phosphate-specific transport system accessory protein PhoU homolog

SCOPe Domain Sequences for d4q25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q25a_ a.7.12.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sqqfnaeledvrshllamgglvekqvndavnalidadsglaqqvreiddqinqmernide
ecvrilarrqpaasdlrliisisksvidlerigdeaskvarraiqlceegesprgyvevr
higsqvqkmvqealdafarfdadlalsvaqydktvdreyktalrelvtymmedpraisrv
lniiwalrslerigdharniaelviylvrgt

SCOPe Domain Coordinates for d4q25a_:

Click to download the PDB-style file with coordinates for d4q25a_.
(The format of our PDB-style files is described here.)

Timeline for d4q25a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q25b_