SCOPe 2.08: Domain d4q1yb_: 4q1y B:

Lineage for d4q1yb_ (4q1y B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d4q1yb_: 4q1y B: [308069]
   automated match to d3ekya_
   complexed with 017, act, po4; mutant

Details for d4q1yb_

PDB Entry: 4q1y, 1.5 Å

PDB Description: Mutations Outside the Active Site of HIV-1 Protease Alter Enzyme Structure and Dynamic Ensemble of the Active Site to Confer Drug Resistance

PDB Compounds: (B:) Aspartyl protease

SCOPe Domain Sequences for d4q1yb_:

Sequence; same for both SEQRES and ATOM records:

>d4q1yb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtifeemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d4q1yb_:

• d4q1yb_ first appeared in SCOPe 2.06
  
• d4q1yb_ appears in SCOPe 2.07