SCOPe 2.08: Domain d4q1ba_: 4q1b A:

Lineage for d4q1ba_ (4q1b A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxycytidine kinase [89657] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89658] (45 PDB entries)

8. Domain d4q1ba_: 4q1b A: [308060]
   automated match to d4jlnb_
   complexed with 2y0, udp; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d4q1ba_

PDB Entry: 4q1b, 2.15 Å

PDB Description: Human dCK C4S-S74E mutant in complex with UDP and the inhibitor 7 {N-(2-(3-(4-(((4,6-diaminopyrimidin-2-yl)thio)methyl)-5-propylthiazol-2-yl)phenoxy)ethyl)methanesulfonamide}

PDB Compounds: (A:) Deoxycytidine kinase

SCOPe Domain Sequences for d4q1ba_:

Sequence, based on SEQRES records:

>d4q1ba_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqstqdefeeltmeqkngg
nvlqmmyekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifas
nlyesesmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqg
ipleyleklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflst
l

Sequence, based on observed residues (ATOM records):

>d4q1ba_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlsedwevvpepvarwstmeqknggnvlqmmyekper
wsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesesmnete
wtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhyk
heswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

Timeline for d4q1ba_:

• d4q1ba_ first appeared in SCOPe 2.06
  
• d4q1ba_ appears in SCOPe 2.07