Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries) |
Domain d4pzda2: 4pzd A:186-284 [308041] Other proteins in same PDB: d4pzda1, d4pzdb1, d4pzdc1, d4pzdd1, d4pzde1, d4pzdf1, d4pzdg1, d4pzdh1, d4pzdi1 automated match to d4pzea2 complexed with nad |
PDB Entry: 4pzd (more details), 2.61 Å
SCOPe Domain Sequences for d4pzda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzda2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]} gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme vlytefadpkyrpamlmremvaagylgrktgrgvyvysk
Timeline for d4pzda2: