SCOPe 2.06: Domain d4pzda2: 4pzd A:186-284

Lineage for d4pzda2 (4pzd A:186-284)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (35 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries)

8. Domain d4pzda2: 4pzd A:186-284 [308041]
   Other proteins in same PDB: d4pzda1, d4pzdb1, d4pzdc1, d4pzdd1, d4pzde1, d4pzdf1, d4pzdg1, d4pzdh1, d4pzdi1
   automated match to d4pzea2
   complexed with nad

Details for d4pzda2

PDB Entry: 4pzd, 2.61 Å

PDB Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 in complex with NAD+

PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzda2:

Sequence; same for both SEQRES and ATOM records:

>d4pzda2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

Timeline for d4pzda2:

• d4pzda2 is new in SCOPe 2.06-stable
  
• d4pzda2 appears in SCOPe 2.07
  
• d4pzda2 appears in the current release, SCOPe 2.08