Lineage for d4pzca2 (4pzc A:186-284)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2335010Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries)
  8. 2335020Domain d4pzca2: 4pzc A:186-284 [308035]
    Other proteins in same PDB: d4pzca1, d4pzcb1, d4pzcc1
    automated match to d4pzea2

Details for d4pzca2

PDB Entry: 4pzc (more details), 2.6 Å

PDB Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pzca2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

SCOPe Domain Coordinates for d4pzca2:

Click to download the PDB-style file with coordinates for d4pzca2.
(The format of our PDB-style files is described here.)

Timeline for d4pzca2: