| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (35 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries) |
| Domain d4pzca2: 4pzc A:186-284 [308035] Other proteins in same PDB: d4pzca1, d4pzcb1, d4pzcc1 automated match to d4pzea2 |
PDB Entry: 4pzc (more details), 2.6 Å
SCOPe Domain Sequences for d4pzca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzca2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk
Timeline for d4pzca2:
View in 3DDomains from other chains: (mouse over for more information) d4pzcb1, d4pzcb2, d4pzcc1, d4pzcc2 |