SCOPe 2.08: Domain d4pzca2: 4pzc A:186-284

Lineage for d4pzca2 (4pzc A:186-284)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [271667] (3 PDB entries)

8. Domain d4pzca2: 4pzc A:186-284 [308035]
   Other proteins in same PDB: d4pzca1, d4pzcb1, d4pzcc1
   automated match to d4pzea2

Details for d4pzca2

PDB Entry: 4pzc, 2.6 Å

PDB Description: Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha

PDB Compounds: (A:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d4pzca2:

Sequence; same for both SEQRES and ATOM records:

>d4pzca2 a.100.1.0 (A:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]}
gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme
vlytefadpkyrpamlmremvaagylgrktgrgvyvysk

Timeline for d4pzca2:

• d4pzca2 first appeared in SCOPe 2.06
  
• d4pzca2 appears in SCOPe 2.07