| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries) |
| Domain d4pzca1: 4pzc A:2-185 [308034] Other proteins in same PDB: d4pzca2, d4pzcb2, d4pzcc2 automated match to d4pzea1 |
PDB Entry: 4pzc (more details), 2.6 Å
SCOPe Domain Sequences for d4pzca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzca1 c.2.1.0 (A:2-185) automated matches {Ralstonia eutropha [TaxId: 381666]}
sirtvgivgagtmgngiaqacavvglnvvmvdisdaavqkgvatvassldrlikkeklte
adkasalarikgstsyddlkatdivieaatenydlkvkilkqidgivgenviiasntssi
sitklaavtsradrfigmhffnpvpvmalvelirglqtsdtthaavealskqlgkypitv
knsp
Timeline for d4pzca1:
View in 3DDomains from other chains: (mouse over for more information) d4pzcb1, d4pzcb2, d4pzcc1, d4pzcc2 |