Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries) GDP-binding protein |
Domain d4pyge4: 4pyg E:586-687 [308032] Other proteins in same PDB: d4pyga1, d4pyga2, d4pyga5, d4pygb1, d4pygb2, d4pygb5, d4pyge1, d4pyge2, d4pyge5 automated match to d3ly6a4 complexed with gtp |
PDB Entry: 4pyg (more details), 2.8 Å
SCOPe Domain Sequences for d4pyge4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pyge4 b.1.5.1 (E:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag eevkvrmdllplhmglhklvvnfesdklkavkgfrnviigpa
Timeline for d4pyge4:
View in 3D Domains from same chain: (mouse over for more information) d4pyge1, d4pyge2, d4pyge3, d4pyge5 |