![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
![]() | Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
![]() | Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
![]() | Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries) GDP-binding protein |
![]() | Domain d4pyge3: 4pyg E:469-585 [308031] Other proteins in same PDB: d4pyga1, d4pyga2, d4pyga5, d4pygb1, d4pygb2, d4pygb5, d4pyge1, d4pyge2, d4pyge5 automated match to d3ly6a3 complexed with gtp |
PDB Entry: 4pyg (more details), 2.8 Å
SCOPe Domain Sequences for d4pyge3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pyge3 b.1.5.1 (E:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky llnlnlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle
Timeline for d4pyge3:
![]() Domains from same chain: (mouse over for more information) d4pyge1, d4pyge2, d4pyge4, d4pyge5 |