| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
| Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
| Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries) GDP-binding protein |
| Domain d4pyge1: 4pyg E:4-145 [308029] Other proteins in same PDB: d4pyga2, d4pyga3, d4pyga4, d4pyga5, d4pygb2, d4pygb3, d4pygb4, d4pygb5, d4pyge2, d4pyge3, d4pyge4, d4pyge5 automated match to d3ly6a1 complexed with gtp |
PDB Entry: 4pyg (more details), 2.8 Å
SCOPe Domain Sequences for d4pyge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pyge1 b.1.18.9 (E:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
gyqgssfvlghfillfnawcpa
Timeline for d4pyge1:
View in 3DDomains from same chain: (mouse over for more information) d4pyge2, d4pyge3, d4pyge4, d4pyge5 |