Lineage for d4pyge1 (4pyg E:4-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765732Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (5 PDB entries)
    GDP-binding protein
  8. 2765748Domain d4pyge1: 4pyg E:4-145 [308029]
    Other proteins in same PDB: d4pyga2, d4pyga3, d4pyga4, d4pyga5, d4pygb2, d4pygb3, d4pygb4, d4pygb5, d4pyge2, d4pyge3, d4pyge4, d4pyge5
    automated match to d3ly6a1
    complexed with gtp

Details for d4pyge1

PDB Entry: 4pyg (more details), 2.8 Å

PDB Description: Transglutaminase2 complexed with GTP
PDB Compounds: (E:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d4pyge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pyge1 b.1.18.9 (E:4-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
elvlercdleletngrdhhtadlcreklvvrrgqpfwltlhfegrnyeasvdsltfsvvt
gpapsqeagtkarfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleast
gyqgssfvlghfillfnawcpa

SCOPe Domain Coordinates for d4pyge1:

Click to download the PDB-style file with coordinates for d4pyge1.
(The format of our PDB-style files is described here.)

Timeline for d4pyge1: