SCOPe 2.07: Domain d4pyga2: 4pyg A:146-468

Lineage for d4pyga2 (4pyg A:146-468)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries)
   GDP-binding protein

8. Domain d4pyga2: 4pyg A:146-468 [308020]
   Other proteins in same PDB: d4pyga1, d4pyga3, d4pyga4, d4pyga5, d4pygb1, d4pygb3, d4pygb4, d4pygb5, d4pyge1, d4pyge3, d4pyge4, d4pyge5
   automated match to d3ly6a2
   complexed with gtp

Details for d4pyga2

PDB Entry: 4pyg, 2.8 Å

PDB Description: Transglutaminase2 complexed with GTP

PDB Compounds: (A:) Protein-glutamine gamma-glutamyltransferase 2

SCOPe Domain Sequences for d4pyga2:

Sequence; same for both SEQRES and ATOM records:

>d4pyga2 d.3.1.4 (A:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk
nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk
nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg
dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls
tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky
pegsseereaftranhlnklaek

Timeline for d4pyga2:

• d4pyga2 first appeared in SCOPe 2.06
  
• d4pyga2 appears in the current release, SCOPe 2.08