![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries) GDP-binding protein |
![]() | Domain d4pyga2: 4pyg A:146-468 [308020] Other proteins in same PDB: d4pyga1, d4pyga3, d4pyga4, d4pyga5, d4pygb1, d4pygb3, d4pygb4, d4pygb5, d4pyge1, d4pyge3, d4pyge4, d4pyge5 automated match to d3ly6a2 complexed with gtp |
PDB Entry: 4pyg (more details), 2.8 Å
SCOPe Domain Sequences for d4pyga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pyga2 d.3.1.4 (A:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfedgildiclilldvnpkflk nagrdcsrrsspvyvgrvvsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky pegsseereaftranhlnklaek
Timeline for d4pyga2:
![]() Domains from same chain: (mouse over for more information) d4pyga1, d4pyga3, d4pyga4, d4pyga5 |