| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in all proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
| Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
| Protein GroEL, A domain [52031] (3 species) |
| Species Escherichia coli [TaxId:562] [52032] (11 PDB entries) |
| Domain d1aona2: 1aon A:191-366 [30802] Other proteins in same PDB: d1aona1, d1aona3, d1aonb1, d1aonb3, d1aonc1, d1aonc3, d1aond1, d1aond3, d1aone1, d1aone3, d1aonf1, d1aonf3, d1aong1, d1aong3, d1aonh1, d1aonh3, d1aoni1, d1aoni3, d1aonj1, d1aonj3, d1aonk1, d1aonk3, d1aonl1, d1aonl3, d1aonm1, d1aonm3, d1aonn1, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |
PDB Entry: 1aon (more details), 3 Å
SCOP Domain Sequences for d1aona2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aona2 c.8.5.1 (A:191-366) GroEL, A domain {Escherichia coli}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1aona2:
View in 3DDomains from other chains: (mouse over for more information) d1aonb1, d1aonb2, d1aonb3, d1aonc1, d1aonc2, d1aonc3, d1aond1, d1aond2, d1aond3, d1aone1, d1aone2, d1aone3, d1aonf1, d1aonf2, d1aonf3, d1aong1, d1aong2, d1aong3, d1aonh1, d1aonh2, d1aonh3, d1aoni1, d1aoni2, d1aoni3, d1aonj1, d1aonj2, d1aonj3, d1aonk1, d1aonk2, d1aonk3, d1aonl1, d1aonl2, d1aonl3, d1aonm1, d1aonm2, d1aonm3, d1aonn1, d1aonn2, d1aonn3, d1aono_, d1aonp_, d1aonq_, d1aonr_, d1aons_, d1aont_, d1aonu_ |