Lineage for d4pwra_ (4pwr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130545Family c.66.1.61: TylF O-methyltransferase-like [310662] (4 protein domains)
    Pfam PF05711
  6. 2130579Protein automated matches [310884] (2 species)
    not a true protein
  7. 2130580Species Micromonospora echinospora [TaxId:1877] [311383] (3 PDB entries)
  8. 2130581Domain d4pwra_: 4pwr A: [308014]
    automated match to d3tosb_
    complexed with so4

Details for d4pwra_

PDB Entry: 4pwr (more details), 1.89 Å

PDB Description: apo structure of cals11, tdp-rhamnose 3'-o-methyltransferase, an enzyme in calicheamicin biosynthesis
PDB Compounds: (A:) CalS11

SCOPe Domain Sequences for d4pwra_:

Sequence, based on SEQRES records: (download)

>d4pwra_ c.66.1.61 (A:) automated matches {Micromonospora echinospora [TaxId: 1877]}
qdlrafvhdspeetettqrltklltnspipteelvnnlplflrrhqmtdllsmdalyrqv
ldvpgvimefgvrfgrhlgtfaalrgvyepynplrrivgfdtftgfpdvndvdrvgptay
qgrfavpggypaylkevldahecsdffghvtqrsvlvegdvretvprylaenpqtviala
yfdldlyeptkavleairpyltkgsivafdeldnpkwpgeniamrkvlgldhaplrllpg
rpapaylrwgd

Sequence, based on observed residues (ATOM records): (download)

>d4pwra_ c.66.1.61 (A:) automated matches {Micromonospora echinospora [TaxId: 1877]}
qdlrafvhdspeetettqrltklltnspipteelvnnlplflrrhqmtdllsmdalyrqv
ldvpgvimefgvrfgrhlgtfaalrgvyepynplrrivgfdtftgrfavpggypaylkev
ldahecsdffghvtqrsvlvegdvretvprylaenpqtvialayfdldlyeptkavleai
rpyltkgsivafdeldnpkwpgeniamrkvlgldhaplrllpgrpapaylrwgd

SCOPe Domain Coordinates for d4pwra_:

Click to download the PDB-style file with coordinates for d4pwra_.
(The format of our PDB-style files is described here.)

Timeline for d4pwra_:

  • d4pwra_ is new in SCOPe 2.06-stable