Lineage for d4pvua_ (4pvu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2009113Domain d4pvua_: 4pvu A: [308010]
    automated match to d3ty0a_
    complexed with mgz

Details for d4pvua_

PDB Entry: 4pvu (more details), 2.6 Å

PDB Description: Crystal structure of the complex between PPARgamma-LBD and the R enantiomer of Mbx-102 (Metaglidasen)
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d4pvua_:

Sequence, based on SEQRES records: (download)

>d4pvua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d4pvua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfev
airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
ktetdmslhpllqeiyk

SCOPe Domain Coordinates for d4pvua_:

Click to download the PDB-style file with coordinates for d4pvua_.
(The format of our PDB-style files is described here.)

Timeline for d4pvua_:

  • d4pvua_ is new in SCOPe 2.06-stable