SCOPe 2.07: Domain d4pt5a2: 4pt5 A:64-324

Lineage for d4pt5a2 (4pt5 A:64-324)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 protein domains)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)

7. Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (5 PDB entries)

8. Domain d4pt5a2: 4pt5 A:64-324 [308009]
   Other proteins in same PDB: d4pt5a1
   automated match to d4p16a2
   complexed with zn

Details for d4pt5a2

PDB Entry: 4pt5, 2.59 Å

PDB Description: Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4pt5a2:

Sequence; same for both SEQRES and ATOM records:

>d4pt5a2 d.3.1.23 (A:64-324) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcn

Timeline for d4pt5a2:

• d4pt5a2 first appeared in SCOPe 2.06