Lineage for d4pt5a2 (4pt5 A:64-324)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927546Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2927547Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries)
  8. 2927551Domain d4pt5a2: 4pt5 A:64-324 [308009]
    Other proteins in same PDB: d4pt5a1
    automated match to d4p16a2
    complexed with zn

Details for d4pt5a2

PDB Entry: 4pt5 (more details), 2.59 Å

PDB Description: Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4pt5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pt5a2 d.3.1.23 (A:64-324) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcn

SCOPe Domain Coordinates for d4pt5a2:

Click to download the PDB-style file with coordinates for d4pt5a2.
(The format of our PDB-style files is described here.)

Timeline for d4pt5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pt5a1