![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
![]() | Protein Papain-like protease PLpro, catalytic domain [310795] (4 species) |
![]() | Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries) |
![]() | Domain d4pt5a2: 4pt5 A:64-324 [308009] Other proteins in same PDB: d4pt5a1 automated match to d4p16a2 complexed with zn |
PDB Entry: 4pt5 (more details), 2.59 Å
SCOPe Domain Sequences for d4pt5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pt5a2 d.3.1.23 (A:64-324) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]} adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts dwkckvtdvlfpgqkyssdcn
Timeline for d4pt5a2: