Lineage for d4pq9a_ (4pq9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390844Species Mycobacterium marinum [TaxId:216594] [311414] (1 PDB entry)
  8. 2390845Domain d4pq9a_: 4pq9 A: [308000]
    automated match to d2vy0b_
    complexed with btb, edo, mg

Details for d4pq9a_

PDB Entry: 4pq9 (more details), 1.2 Å

PDB Description: crystal structure of a beta-1,3-glucanase from mycobacterium marinum
PDB Compounds: (A:) Beta-1,3-glucanase

SCOPe Domain Sequences for d4pq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pq9a_ b.29.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
qsgpylfhdefdgpagsapdsskwtvarareemkdptywerpenvgqyrddrqnvfldgk
snlviraakdggtyyagkiqspwrggightwearikfdcltagcwpawwlgnqdrgeidi
iewygngswpsattvhakangsewktrnvaldsgwhtwrcqwdetgmrfwqdyaegaqpy
ftvaahslpdwpfndpgytvfpvlnlavagsgggdprpgsypaqmlvdwvrvw

SCOPe Domain Coordinates for d4pq9a_:

Click to download the PDB-style file with coordinates for d4pq9a_.
(The format of our PDB-style files is described here.)

Timeline for d4pq9a_: