![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Mycobacterium marinum [TaxId:216594] [311414] (1 PDB entry) |
![]() | Domain d4pq9a_: 4pq9 A: [308000] automated match to d2vy0b_ complexed with btb, edo, mg |
PDB Entry: 4pq9 (more details), 1.2 Å
SCOPe Domain Sequences for d4pq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pq9a_ b.29.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]} qsgpylfhdefdgpagsapdsskwtvarareemkdptywerpenvgqyrddrqnvfldgk snlviraakdggtyyagkiqspwrggightwearikfdcltagcwpawwlgnqdrgeidi iewygngswpsattvhakangsewktrnvaldsgwhtwrcqwdetgmrfwqdyaegaqpy ftvaahslpdwpfndpgytvfpvlnlavagsgggdprpgsypaqmlvdwvrvw
Timeline for d4pq9a_: