SCOPe 2.08: Domain d4pq9a_: 4pq9 A:

Lineage for d4pq9a_ (4pq9 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [311414] (1 PDB entry)

8. Domain d4pq9a_: 4pq9 A: [308000]
   automated match to d2vy0b_
   complexed with btb, edo, mg

Details for d4pq9a_

PDB Entry: 4pq9, 1.2 Å

PDB Description: crystal structure of a beta-1,3-glucanase from mycobacterium marinum

PDB Compounds: (A:) Beta-1,3-glucanase

SCOPe Domain Sequences for d4pq9a_:

Sequence; same for both SEQRES and ATOM records:

>d4pq9a_ b.29.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
qsgpylfhdefdgpagsapdsskwtvarareemkdptywerpenvgqyrddrqnvfldgk
snlviraakdggtyyagkiqspwrggightwearikfdcltagcwpawwlgnqdrgeidi
iewygngswpsattvhakangsewktrnvaldsgwhtwrcqwdetgmrfwqdyaegaqpy
ftvaahslpdwpfndpgytvfpvlnlavagsgggdprpgsypaqmlvdwvrvw

Timeline for d4pq9a_:

• d4pq9a_ first appeared in SCOPe 2.06
  
• d4pq9a_ appears in SCOPe 2.07