SCOPe 2.08: Domain d4p57c1: 4p57 C:2-83

Lineage for d4p57c1 (4p57 C:2-83)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4p57c1: 4p57 C:2-83 [307980]
   Other proteins in same PDB: d4p57a2, d4p57c2
   automated match to d1muja2
   complexed with ca, gol, nag

Details for d4p57c1

PDB Entry: 4p57, 2.6 Å

PDB Description: mhc tcr peptide complex

PDB Compounds: (C:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p57c1:

Sequence; same for both SEQRES and ATOM records:

>d4p57c1 d.19.1.0 (C:2-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
niailnnnlntliqrsnhtqat

Timeline for d4p57c1:

• d4p57c1 first appeared in SCOPe 2.06
  
• d4p57c1 appears in SCOPe 2.07